The domain within your query sequence starts at position 539 and ends at position 600; the E-value for the RNA_pol_Rpb2_4 domain shown below is 1e-29.
VFLNGNILGVIRDHKKLVSTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYII VK
RNA_pol_Rpb2_4 |
---|
PFAM accession number: | PF04566 |
---|---|
Interpro abstract (IPR007646): | RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). Domain 4 is also known as the external 2 domain [ (PUBMED:11313498) ]. |
GO process: | transcription, DNA-templated (GO:0006351) |
GO function: | DNA binding (GO:0003677), DNA-directed 5'-3' RNA polymerase activity (GO:0003899) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_4