The domain within your query sequence starts at position 621 and ends at position 661; the E-value for the RNA_pol_Rpb2_5 domain shown below is 6.5e-14.
FEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIEP
RNA_pol_Rpb2_5 |
![]() |
---|
PFAM accession number: | PF04567 |
---|---|
Interpro abstract (IPR007647): | RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). Domain 5 is also known as the external 2 domain [ (PUBMED:11313498) ]. |
GO process: | transcription, DNA-templated (GO:0006351) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpb2_5