The domain within your query sequence starts at position 1 and ends at position 105; the E-value for the RNA_pol_Rpc34 domain shown below is 6.2e-20.
MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSM GQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNK
RNA_pol_Rpc34 |
---|
PFAM accession number: | PF05158 |
---|---|
Interpro abstract (IPR007832): | The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase. The C34 subunit of Saccharomyces cerevisiae RNA Pol III is part of a subcomplex of three subunits which have no counterpart in the other two nuclear RNA polymerases. This subunit interacts with TFIIIB70 and therefore participates in Pol III recruitment [ (PUBMED:9312031) ]. |
GO process: | transcription by RNA polymerase III (GO:0006383) |
GO component: | RNA polymerase III complex (GO:0005666) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpc34