The domain within your query sequence starts at position 1 and ends at position 105; the E-value for the RNA_pol_Rpc34 domain shown below is 6.2e-20.

MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSM
GQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNK

RNA_pol_Rpc34

RNA_pol_Rpc34
PFAM accession number:PF05158
Interpro abstract (IPR007832):

The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase. The C34 subunit of Saccharomyces cerevisiae RNA Pol III is part of a subcomplex of three subunits which have no counterpart in the other two nuclear RNA polymerases. This subunit interacts with TFIIIB70 and therefore participates in Pol III recruitment [ (PUBMED:9312031) ].

GO process:transcription by RNA polymerase III (GO:0006383)
GO component:RNA polymerase III complex (GO:0005666)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rpc34