The domain within your query sequence starts at position 4 and ends at position 128; the E-value for the RNase_P_pop3 domain shown below is 2.6e-8.

ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPL
EIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSI
ERLLV

RNase_P_pop3

RNase_P_pop3
PFAM accession number:PF08228
Interpro abstract (IPR013241):

This family of fungal proteins form a subunit of RNase P, the ribonucleoprotein enzyme that cleaves the leader sequence of precursor tRNAs to generate mature tRNAs. The structure of Pop3 has been assigned the L7Ae/L30e fold [ (PUBMED:15613537) ]. This RNA-binding fold is also present in human RNase P subunit Rpp38, raising the possibility that Pop3p and Rpp38 are functional homologues.

GO process:tRNA processing (GO:0008033), rRNA processing (GO:0006364)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNase_P_pop3