The domain within your query sequence starts at position 1 and ends at position 43; the E-value for the ROKNT domain shown below is 7.6e-24.

METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMV

ROKNT

• PFAM accession number: PF08067
• Interpro abstract (IPR012987):

  This presumed domain is found at the N terminus of RNP K-like proteins that also contain KH domains IPR004088 [ (PUBMED:15112237) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ROKNT