The domain within your query sequence starts at position 225 and ends at position 270; the E-value for the RPAP1_N domain shown below is 2.4e-21.

QTIHEENVARLQAMDPEEILKEQQQLLAQLDPSLVAFLRSHSQVQE

RPAP1_N

 RPAP1_N
PFAM accession number:PF08621
Interpro abstract (IPR013930):

Inhibition of RNA polymerase II-associated protein 1 (RPAP1) synthesis in Saccharomyces cerevisiae (Baker's yeast) results in changes in global gene expression that are similar to those caused by the loss of the RNAPII subunit Rpb11 [ (PUBMED:15282305) ]. This entry represents the N-terminal region of RPAP-1 that is conserved from yeast to humans.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPAP1_N