The domain within your query sequence starts at position 136 and ends at position 217; the E-value for the RPA_interact_C domain shown below is 2.8e-21.
ICPVCIKYNLRIMNSVVTCPCGLHIPVHSTDLTEQKLRACLEENVNEHSVHCPHTPVFSV TGGTEEKPSLLMNCLTCDTWAV
RPA_interact_C |
---|
PFAM accession number: | PF14768 |
---|---|
Interpro abstract (IPR028159): | This entry represents the C-terminal domain of replication protein A (RPA) interacting protein (RIP). RPA is a single stranded DNA-binding protein involved in DNA replication, repair, and recombination [ (PUBMED:19192389) ]. RPA interacting protein is involved in the import of RPA into the nucleus [ (PUBMED:10428972) (PUBMED:16135809) ]. The C-terminal domain contains a putative zinc finger [ (PUBMED:16135809) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPA_interact_C