SMART: Pfam domain RPA_interact

The domain within your query sequence starts at position 136 and ends at position 217; the E-value for the RPA_interact_C domain shown below is 2.8e-21.

ICPVCIKYNLRIMNSVVTCPCGLHIPVHSTDLTEQKLRACLEENVNEHSVHCPHTPVFSV
TGGTEEKPSLLMNCLTCDTWAV

RPA_interact_C

PFAM accession number:	PF14768
Interpro abstract (IPR028159):	This entry represents the C-terminal domain of replication protein A (RPA) interacting protein (RIP). RPA is a single stranded DNA-binding protein involved in DNA replication, repair, and recombination [ (PUBMED:19192389) ]. RPA interacting protein is involved in the import of RPA into the nucleus [ (PUBMED:10428972) (PUBMED:16135809) ]. The C-terminal domain contains a putative zinc finger [ (PUBMED:16135809) ].

PFAM accession number:

PF14768

Interpro abstract (IPR028159):

This entry represents the C-terminal domain of replication protein A (RPA) interacting protein (RIP). RPA is a single stranded DNA-binding protein involved in DNA replication, repair, and recombination [ (PUBMED:19192389) ]. RPA interacting protein is involved in the import of RPA into the nucleus [ (PUBMED:10428972) (PUBMED:16135809) ]. The C-terminal domain contains a putative zinc finger [ (PUBMED:16135809) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RPA_interact_C