The domain within your query sequence starts at position 488 and ends at position 592; the E-value for the RQC domain shown below is 1.1e-8.
NVTQHCRDLIKILKQAEGLNEKLTPLKLIDAWMGKGAAKLRVAGVVAPALPREDLERIVA HALLQQYLKEDYSFTAYATISYLKVGPRACLLSNEAHAVTMQVKK
RQC |
![]() |
---|
PFAM accession number: | PF09382 |
---|---|
Interpro abstract (IPR018982): | This entry represents the RQC domain, which is a DNA-binding domain found only in RecQ family enzymes. RecQ family helicases can unwind G4 DNA, and play important roles at G-rich domains of the genome, including the telomeres, rDNA, and immunoglobulin switch regions. This domain has a helix-turn-helix structure and acts as a high affinity G4 DNA binding domain [ (PUBMED:16530788) ]. Binding of RecQ to Holliday junctions involves both the RQC and the HRDC domains. |
GO process: | DNA repair (GO:0006281), DNA replication (GO:0006260) |
GO function: | 3'-5' DNA helicase activity (GO:0043138) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RQC