SMART: Pfam domain RSB

The domain within your query sequence starts at position 1065 and ends at position 1180; the E-value for the RSB_motif domain shown below is 1.1e-29.

RAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKS
KEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTESQIVQKEAEQAERAKE

RSB_motif

PFAM accession number:	PF16294
Interpro abstract (IPR032552):	The RSB motif on the Acinus (also known as Acin1) protein is the core around which the ASAP complex is built. The apoptosis and splicing-associated protein complex, ASAP, is made up of three proteins, SAP18 (Sin3-associated protein of 18kDa), RNA-binding protein S1 (RNPS1) and apoptotic chromatin inducer in the nucleus (Acinus). The ASAP complex appears to be an assembly of proteins at the interface between transcription, splicing and nonsense-mediated mRNA decay (NMD), acting as a hub in the network of protein-interactions that regulate gene-expression [ (PUBMED:22388736) ].

PFAM accession number:

PF16294

Interpro abstract (IPR032552):

The RSB motif on the Acinus (also known as Acin1) protein is the core around which the ASAP complex is built. The apoptosis and splicing-associated protein complex, ASAP, is made up of three proteins, SAP18 (Sin3-associated protein of 18kDa), RNA-binding protein S1 (RNPS1) and apoptotic chromatin inducer in the nucleus (Acinus). The ASAP complex appears to be an assembly of proteins at the interface between transcription, splicing and nonsense-mediated mRNA decay (NMD), acting as a hub in the network of protein-interactions that regulate gene-expression [ (PUBMED:22388736) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RSB_motif