The domain within your query sequence starts at position 2 and ends at position 81; the E-value for the RUN domain shown below is 1.5e-8.
SFICSQDKLKTSLGKGRAFIRLCLARGQLAESMQLCLLNPQLTREWYGPRSPLLCAELQE DILDSLYALNGVAFNLDLQR
RUN |
![]() |
---|
PFAM accession number: | PF02759 |
---|---|
Interpro abstract (IPR004012): | The RUN domain, named after RPIP8, unc-14 and NESCA, is organised into six conserved blocks (A-F), which are predicted to constitute the 'core' of a globular structure tolerating insertions of considerable length between the conserved blocks. The RUN domain is found in one or two copies in several proteins that are linked particularly to the functions of GTPases in the Rap and Rab families. RUN domains can be associated with TBC/rab GAP, FYVE, DENN, SH3, DAG/PE-binding, PLAT/LH2, PH or PX domains. The RUN domain may have a role in the interaction of various proteins with cytoskeletal filaments [ (PUBMED:11509568) ]. The predicted secondary structures of the RUN domain core indicate a predominantly alpha fold [ (PUBMED:11166556) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RUN