The domain within your query sequence starts at position 528 and ends at position 723; the E-value for the Rab5-bind domain shown below is 1.4e-50.
ELQQSFSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQLAEDFILP DTVEVLRELVLKYRENIVHVRTAADHMEEKLKAEILFLKEQIQAEQCLKENLEETLQLEI ENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEMKVNLEEQLKKETAAKA TVEQLMFEEKNKAQRL
Rab5-bind |
![]() |
---|
PFAM accession number: | PF09311 |
---|---|
Interpro abstract (IPR015390): | This domain is predominantly found in Rabaptin and allows for binding to the GTPase Rab5. This interaction is necessary and sufficient for Rab5-dependent recruitment of Rabaptin5 to early endosomal membranes [ (PUBMED:15378032) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rab5-bind