SMART: Pfam domain Rab5ip

The domain within your query sequence starts at position 24 and ends at position 104; the E-value for the Rab5ip domain shown below is 6.8e-28.

AVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRP
LFTGGLIGGLFTYVLFWTFLY

Rab5ip

PFAM accession number:	PF07019
Interpro abstract (IPR029008):	This family consists of several Rab5-interacting proteins, such as C20orf24 and EMC6. Rab5-Interacting Protein (C20orf24) may function on endocytic vesicles as a receptor for Rab5-GDP and participate in the activation of Rab5 [ (PUBMED:10818110) ]. ER membrane protein complex subunit 6 (EMC6) is a novel endoplasmic reticulum (ER)-localised transmembrane protein that interacts with both Rab5A and BECN1/Beclin 1. It has been shown to regulate autophagosome formation [ (PUBMED:23182941) ].

PFAM accession number:

PF07019

Interpro abstract (IPR029008):

This family consists of several Rab5-interacting proteins, such as C20orf24 and EMC6. Rab5-Interacting Protein (C20orf24) may function on endocytic vesicles as a receptor for Rab5-GDP and participate in the activation of Rab5 [ (PUBMED:10818110) ]. ER membrane protein complex subunit 6 (EMC6) is a novel endoplasmic reticulum (ER)-localised transmembrane protein that interacts with both Rab5A and BECN1/Beclin 1. It has been shown to regulate autophagosome formation [ (PUBMED:23182941) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rab5ip