The domain within your query sequence starts at position 152 and ends at position 210; the E-value for the Rab_eff_C domain shown below is 5.4e-34.

CFDILGGGLFEPNLENEGSISGSDSTFYRQSEGHSMMDTLAVALRVAEEAIEEAISKAE

Rab_eff_C

 Rab_eff_C
PFAM accession number:PF04698
Interpro abstract (IPR006788):

This domain is found in Rab effector MyRIP and melanophilin. They are both Rab effector proteins involved in melanosome transport [ (PUBMED:17827149) (PUBMED:11887186) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rab_eff_C