SMART: Pfam domain Rad51

The domain within your query sequence starts at position 73 and ends at position 341; the E-value for the Rad51 domain shown below is 1.9e-32.

NEKCTALELLEQEHTQGFIITFCSALDNILGGGIPLMKTTEVCGVPGVGKTQLCMQLAVD
VQIPECFGGVAGEAVFIDTEGSFMVDRVVSLATACIQHLHLIAGTHTEEEHQKALKDFTL
ENILSHIYYFRCHDYTELLAQVYLLPDFLSDHPKVQLVIIDGIAFPFRHDLEDLSLRTRL
LNGLAQQMISLANNHRLAVILTNQMTTKIDKNQALLVPALGESWGHAATIRLIFHWEQKQ
RFATLYKSPSQKESTIPFQITPQGFRDAV

Rad51

PFAM accession number:	PF08423
Interpro abstract (IPR013632):	This domain is found at the C terminus of DNA repair and recombination protein Rad51, and eukaryotic and archaeal Rad51-like proteins. It is critical for DNA binding [ (PUBMED:15908697) ]. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain. Unlike eubacteria, several archaeal species have two recA/RAD51-like genes, called RadA and RadB. Among eukaryotes, yeast contain four RAD51-like genes (RAD51, DMC1, RAD55/rhp55, and RAD57/rhp57). In vertebrate animals and plants, there are different RAD51-like genes: RAD51, RAD51B, RAD51C, RAD51D, DMC1, XRCC2, and XRCC3 [ (PUBMED:16798872) ].

PFAM accession number:

PF08423

Interpro abstract (IPR013632):

This domain is found at the C terminus of DNA repair and recombination protein Rad51, and eukaryotic and archaeal Rad51-like proteins. It is critical for DNA binding [ (PUBMED:15908697) ]. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain.

Unlike eubacteria, several archaeal species have two recA/RAD51-like genes, called RadA and RadB. Among eukaryotes, yeast contain four RAD51-like genes (RAD51, DMC1, RAD55/rhp55, and RAD57/rhp57). In vertebrate animals and plants, there are different RAD51-like genes: RAD51, RAD51B, RAD51C, RAD51D, DMC1, XRCC2, and XRCC3 [ (PUBMED:16798872) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad51