The domain within your query sequence starts at position 10 and ends at position 138; the E-value for the Rad54_N domain shown below is 7.8e-9.

LARRKPEDRSSDDEDWQPGTVTPKKRKSSSETQVQECFLSPFRKPLTQLLNRPPCLDSSQ
HEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEEGALVLYEPPPLSAH
DQLKLDKEK

Rad54_N

 Rad54_N
PFAM accession number:PF08658
Interpro abstract (IPR013967):

This is the N-terminal of the DNA repair protein Rad54 [ (PUBMED:14551247) ]. Rad54 functions in the recombinational DNA repair (RAD52) pathway. It dissociates RAD51 from nucleoprotein filaments formed on dsDNA and could be involved in the turnover of RAD51 protein-dsDNA filaments. Deficient mice also show significantly shorter telomeres than wild-type controls, indicating that the protein activity plays an essential role in telomere length maintenance in mammals. Non-homologous end joining (NHEJ) and homologous recombination (HR) represent the two major pathways of DNA double-strand break (DSB) repair in eukaryotic cells. LIG4 and RAD54L cooperate to support cellular proliferation, repair spontaneous DSBs, and prevent chromosome and single chromatid aberrations [ (PUBMED:9590697) (PUBMED:12453424) ].

GO function:hydrolase activity, acting on acid anhydrides (GO:0016817)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad54_N