The domain within your query sequence starts at position 1 and ends at position 45; the E-value for the Rad60-SLD domain shown below is 1.1e-17.
MKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQ
Rad60-SLD |
![]() |
---|
PFAM accession number: | PF11976 |
---|---|
Interpro abstract (IPR022617): | This entry includes small ubiquitin-related modifier (SUMO) proteins. SUMOs are small proteins that are covalently attached to lysines as post-translational modifications and are used to control multiple cellular process including signal transduction, nuclear transport and DNA replication and repair [ (PUBMED:15808504) ]. Unlike ubiquitin, they are not involved in protein degradation. This entry also contains the C-terminal Rad60 DNA repair protein SUMO-like domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad60-SLD