SMART: Pfam domain Rad60-SLD

The domain within your query sequence starts at position 18 and ends at position 52; the E-value for the Rad60-SLD domain shown below is 3.4e-9.

INLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQL

Rad60-SLD

PFAM accession number:	PF11976
Interpro abstract (IPR022617):	This entry includes small ubiquitin-related modifier (SUMO) proteins. SUMOs are small proteins that are covalently attached to lysines as post-translational modifications and are used to control multiple cellular process including signal transduction, nuclear transport and DNA replication and repair [ (PUBMED:15808504) ]. Unlike ubiquitin, they are not involved in protein degradation. This entry also contains the C-terminal Rad60 DNA repair protein SUMO-like domain.

PFAM accession number:

PF11976

Interpro abstract (IPR022617):

This entry includes small ubiquitin-related modifier (SUMO) proteins. SUMOs are small proteins that are covalently attached to lysines as post-translational modifications and are used to control multiple cellular process including signal transduction, nuclear transport and DNA replication and repair [ (PUBMED:15808504) ]. Unlike ubiquitin, they are not involved in protein degradation.

This entry also contains the C-terminal Rad60 DNA repair protein SUMO-like domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad60-SLD