The domain within your query sequence starts at position 8 and ends at position 114; the E-value for the Rad60-SLD_2 domain shown below is 1.7e-34.
DMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFL HGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC
Rad60-SLD_2 |
 |
|---|
| PFAM accession number: | PF13881 |
|---|---|
| Interpro abstract (IPR039540): | This entry represents the ubiquitin domain found in ubiquitin-like protein 3 (UBL3) [ (PUBMED:10375635) ] and related proteins, such as MUB1-6 from Arabidopsis [ (PUBMED:21345795) ]. The AtMUB proteins localize a specific subset of ubiquitin-conjugating (E2) enzymes to the plasma membrane [ (PUBMED:21345795) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad60-SLD_2