The domain within your query sequence starts at position 1 and ends at position 207; the E-value for the Raftlin domain shown below is 1.5e-104.
MEIFAFFNRPKSQQKCRQYYPVTIPLQVSKNGQTVSSLDASWLEHMSDHFRKGGVLVNAV FQLGMANDSFYGLTDGVFIFEAVSTEDNRTTQGYDAIVVEQWTVLEGTEVQTDYMPLLNS LAAYGWQLTCVLPTPILKTTREGNVSTKQIVFLQRPCLPQKTKKRESKFQWRFSRNEIHG RQTRKSKGKLSASNKQQAEENEKNLED
Raftlin |
![]() |
---|
PFAM accession number: | PF15250 |
---|---|
Interpro abstract (IPR028169): | Raftlin plays an important role in the formation and/or maintenance of lipid rafts [ (PUBMED:12805216) ]. In B-cells, Raftlin is localised exclusively in lipid rafts by fatty acylation of N-terminal Gly2 and Cys3, and is co-localised with B-cell antigen receptor (BCR) [ (PUBMED:12805216) ]. The raftin family consists of Raftin and Raftin-2. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Raftlin