The domain within your query sequence starts at position 1824 and ends at position 2003; the E-value for the Rap_GAP domain shown below is 7.4e-66.
ILTNIGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQKNRSTGLTTPYFATSTVEVIFHVST RMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRGIIPTEFGDVLIVIYPMKNHMFSIQ IMKKPEVPFFGPLFDGAIVNGKVLPIMVRSTAINASRALKSLIPLYQNFYEERARYLQTI
Rap_GAP |
---|
PFAM accession number: | PF02145 |
---|---|
Interpro abstract (IPR000331): | Rap small G proteins have been implicated in various cellular processes such as exocytosis, cAMP signalling, cell adhesion and cell proliferation. Rap proteins acts as molecular switches, with an active GTP-bound form and an inactive GDP-bound form [ (PUBMED:11331911) ]. The inactive GDP bound form is promoted by GTPase-activating proteins (GAPs). GAP proteins specific for Rap contain a conserved region of around 200 amino-acid residues, the RapGAP domain. This domain can accelerate the GTP hydrolysis activity of Rap by five orders of magnitude [ (PUBMED:9346962) ]. Proteins known to contain a Rap-GAP domain include:
|
GO process: | regulation of small GTPase mediated signal transduction (GO:0051056) |
GO function: | GTPase activator activity (GO:0005096) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rap_GAP