The domain within your query sequence starts at position 1367 and ends at position 1498; the E-value for the RasGAP_C domain shown below is 3.2e-40.

LEQKKRKIQRNLRTLEQTGHVSSKNKYQDILNEIAKDIRNQRIHRKLRKAELSKLQQTLN
ALNKKAAFYEDQINYYDTYIKTCVDNLKRKNSRRSIKLDGKAEPKGTKRVKPVRYTAAKL
HDKGVLLGIDDL

RasGAP_C

• PFAM accession number: PF03836
• Interpro abstract (IPR000593):

  This domain can be found in the C terminus of the IQGAP family members, including human IQGAP1/2/3, S. cerevisiae Iqg1 and S. pombe Rng2. Some members function in cytoskeletal remodelling [ (PUBMED:20335501) ]. Human IQGAP1 is a scaffolding protein that can assemble multi-protein complexes involved in cell-cell interaction, cell adherence, and movement via actin/tubulin-based cytoskeletal reorganization [ (PUBMED:11112700) ]. IQGAP1 is also a regulator of the MAPK and Wnt/beta-catenin signaling pathways [ (PUBMED:20335501) ]. Iqg1 and Rng2 are required for actomyosin ring construction during cytokinesis [ (PUBMED:11854008) (PUBMED:9635188) ].

• GO function: protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RasGAP_C