The domain within your query sequence starts at position 10 and ends at position 69; the E-value for the RecQ_Zn_bind domain shown below is 7.1e-16.

FGDIFRISSMVVMENVGQQKLYEMVSYCQNVSKCRRVLIAQHFDEVWNADACNKMCDNCC

RecQ_Zn_bind

 RecQ_Zn_bind
PFAM accession number:PF16124
Interpro abstract (IPR032284):

This domain is the zinc-binding domain of ATP-dependent DNA helicase RecQ [ (PUBMED:14517231) (PUBMED:19151156) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RecQ_Zn_bind