The domain within your query sequence starts at position 494 and ends at position 584; the E-value for the Receptor_IA-2 domain shown below is 2.5e-43.

EEQQGYILTGNNPLSPEKGKQLMDQVAHILRVPSSFFADIKVLGPAVTFKVSANIQNMTT
ADVIKAAADNKDQLEKATGLTILQSGIRPKG

Receptor_IA-2

• PFAM accession number: PF11548
• Interpro abstract (IPR021613):

  IA-2 (also known as PTPRN or ICA512) and phogrin (also known as PTPRN2, IA-2b, IAR or ICAAR) are homologous protein-tyrosine phosphatase (PTP) receptors. They have a signal peptide, an ectodomain, a single-pass transmembrane region, and a single intracellular PTP domain. Processing of pro IA-2 by furin-like hormone convertases produces mature IA-2, which lacks the signal peptide and an adjacent fragment (residues 1-448). Upon exocytosis, the cytoplasmic domain of IA-2 is cleaved and moves to the nucleus where it enhances transcription of the insulin gene [ (PUBMED:15596545) ]. The mature ectodomain of IA-2 participates in adhesion to the extracellular matrix and is self-proteolysed in vitro by reactive oxygen species, which may be a new shedding mechanism [ (PUBMED:18048354) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Receptor_IA-2