The domain within your query sequence starts at position 381 and ends at position 558; the E-value for the RelB_transactiv domain shown below is 3.2e-98.
DSYGVDKKRKRGLPDVLGELSSSDPHGIESKRRKKKPVFLDHFLPGHSSGLFLPPSALQP ADSDFFPASISLPGLEPPGGPDLLDDGFAYDPSAPTLFTMLDLLPPAPPLASAVVGSGGA GATVVESSGPEPLSLDSFAAPGPGDVGTASLVGSNMFPNQYREAAFGGGLLSPGPEAT
RelB_transactiv |
![]() |
---|
PFAM accession number: | PF16181 |
---|---|
Interpro abstract (IPR032400): | This domain is the transactivation domain of the transcription factor RelB [ (PUBMED:17869269) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RelB_transactiv