SMART: Pfam domain Rep_fac

The domain within your query sequence starts at position 269 and ends at position 344; the E-value for the Rep_fac_C domain shown below is 3.5e-10.

IPAATIDGIFTACHSGSFDKLEAVVKNLIDEGHAATQLVNQLHDAIIENENLSDKHKSII
TEKLAVSCKHYTSTTT

Rep_fac_C

PFAM accession number:	PF08542
Interpro abstract (IPR013748):	This is the C-terminal domain of RFC (replication factor-C) protein of the clamp loader complex which binds to the DNA sliding clamp (proliferating cell nuclear antigen, PCNA). The five modules of RFC assemble into a right-handed spiral, which results in only three of the five RFC subunits (RFC-A, RFC-B and RFC-C) making contact with PCNA, leaving a wedge-shaped gap between RFC-E and the PCNA clamp-loader complex. The C-terminal is vital for the correct orientation of RFC-E with respect to RFC-A [ (PUBMED:15201901) ].

PFAM accession number:

PF08542

Interpro abstract (IPR013748):

This is the C-terminal domain of RFC (replication factor-C) protein of the clamp loader complex which binds to the DNA sliding clamp (proliferating cell nuclear antigen, PCNA). The five modules of RFC assemble into a right-handed spiral, which results in only three of the five RFC subunits (RFC-A, RFC-B and RFC-C) making contact with PCNA, leaving a wedge-shaped gap between RFC-E and the PCNA clamp-loader complex. The C-terminal is vital for the correct orientation of RFC-E with respect to RFC-A [ (PUBMED:15201901) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rep_fac_C