The domain within your query sequence starts at position 475 and ends at position 617; the E-value for the ResIII domain shown below is 1.3e-6.
PDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVD QLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELS SADEKRYRALKRTAERELLMNAD
ResIII |
![]() |
---|
PFAM accession number: | PF04851 |
---|---|
Interpro abstract (IPR006935): | This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases ( EC 3.1.21.3 ), the Res subunit of type III endonucleases ( EC 3.1.21.5 ), and the B subunit of excinuclease ABC (uvrB) [ (PUBMED:11178902) (PUBMED:9628345) (PUBMED:16125908) ]. |
GO function: | DNA binding (GO:0003677), hydrolase activity (GO:0016787), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ResIII