SMART: Pfam domain Retrotrans

The domain within your query sequence starts at position 195 and ends at position 288; the E-value for the Retrotrans_gag domain shown below is 5.8e-13.

AFLISFFTGEARDWAISVTQEGSSLHANFPRFLDEIRKEFCGPIPSRVAKKAIRKLKQGN
CTLGSYADAFQFLAQFLSWDDCRLQNQFLKGLSE

Retrotrans_gag

PFAM accession number:	PF03732
Interpro abstract (IPR005162):	Transposable elements (TEs) promote various chromosomal rearrangements more efficiently, and often more specifically, than other cellular processes. Retrotransposons are structurally similar to retroviruses and are bounded by long terminal repeats. This entry represents eukaryotic Gag or capsid-related retrotranspon-related proteins. There is a central motif QGXXEXXXXXFXXLXXH that is common to Retroviridae gag-proteins, but is poorly conserved [ (PUBMED:11600699) ].

PFAM accession number:

PF03732

Interpro abstract (IPR005162):

Transposable elements (TEs) promote various chromosomal rearrangements more efficiently, and often more specifically, than other cellular processes. Retrotransposons are structurally similar to retroviruses and are bounded by long terminal repeats. This entry represents eukaryotic Gag or capsid-related retrotranspon-related proteins. There is a central motif QGXXEXXXXXFXXLXXH that is common to Retroviridae gag-proteins, but is poorly conserved [ (PUBMED:11600699) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Retrotrans_gag