The domain within your query sequence starts at position 98 and ends at position 306; the E-value for the Rhomboid_SP domain shown below is 1.8e-98.
VSGDWEGKRQNWHRRSLHHCSVHYGRLKASCQRELELPSQEVPSFQGTESPKPCKMPKIV DPLARGRAFRHPDEVDRPHAAHPPLTPGVLSLTSFTSVRSGYSHLPRRKRISVAHMSFQA AAALLKGRSVLDATGQRCRHVKRSFAYPSFLEEDAVDGADTFDSSFFSKEEMSSMPDDVF ESPPLSASYFRGVPHSASPVSPDGVHIPL
Rhomboid_SP |
---|
PFAM accession number: | PF12595 |
---|---|
Interpro abstract (IPR022241): | This domain family is found in eukaryotes, and is approximately 210 amino acids in length. The family is found in association with . Rhomboid is a seven-transmembrane spanning protein that resides in the Golgi and acts as a serine protease to cleave Spitz. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rhomboid_SP