The domain within your query sequence starts at position 33 and ends at position 173; the E-value for the Rib_recp_KP_reg domain shown below is 2.8e-47.
MKETSYEEALANQRKEMAKTHHQKGEKKKKEKTVEKKGKTKKKEEKPNGKIPEHDLDPNV TIILKEPVRVSAVAVAPTSVHSSVGHTPIATVPAMPQEKLASSPKDRKKKEKKVAKVEPA VSSIVNSIQVLASKSAILEAT
Rib_recp_KP_reg |
---|
PFAM accession number: | PF05104 |
---|---|
Interpro abstract (IPR007794): | The ribosome receptor is an integral endoplasmic reticulum protein that has been suggested to be involved in secretion. This highly conserved region is found towards the C terminus of the transmembrane domain [ (PUBMED:11836413) ]. The function is unclear. |
GO process: | protein transport (GO:0015031) |
GO component: | integral component of endoplasmic reticulum membrane (GO:0030176) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rib_recp_KP_reg