The domain within your query sequence starts at position 2 and ends at position 71; the E-value for the Ribophorin_II domain shown below is 1.5e-15.
APPGSSAVFLLALTITASVQALTPTHYLTKQDVERLKASLDRPFTDLESAFYSIVGLSSL GVQVPDVKIS
Ribophorin_II |
 |
|---|
| PFAM accession number: | PF05817 |
|---|---|
| Interpro abstract (IPR008814): | Swp1 is an essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyses the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains [ (PUBMED:8175708) ]. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity [ (PUBMED:15831493) ]. |
| GO process: | protein N-linked glycosylation (GO:0006487) |
| GO component: | integral component of membrane (GO:0016021), oligosaccharyltransferase complex (GO:0008250) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribophorin_II