The domain within your query sequence starts at position 192 and ends at position 283; the E-value for the Ribosomal_L18_c domain shown below is 2.2e-42.
AEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENP VYEKKPKREVKKKRWNRPKMSLAQKKDRVAQK
Ribosomal_L18_c |
![]() |
---|
PFAM accession number: | PF14204 |
---|---|
Interpro abstract (IPR025607): | This entry represents the C-terminal domain of ribosomal eukaryotic L5 proteins and archaeal L18 proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribosomal_L18_c