SMART: Pfam domain Rif1

The domain within your query sequence starts at position 18 and ends at position 381; the E-value for the Rif1_N domain shown below is 1.4e-85.

DPSVPPGEQTDAYLTLTSRMTGEEGKEVIAEIEKNLSRLYTVLKAHISSQNSELSSAALQ
ALGFCLYNPRITSGLSEANIQELLLTLNGIIKSSDKNVCTRALWVISKQTFPAELVSKMV
SSIIDSLEVILSKGEIHSAVVDFEALNVIISHWFLHCRLIEQAPVQMGEESVRWAKLVIP
LVVHSAQKVHLRGATALEMGMPLLLQKQQEIALITEHLMTTKLISELQKLFKNKNETYVL
KLWPLFVKLLGKTLHRSGSFINSLLQLEELGFRSGTPMIKKIAFIAWKSLIDNFALNPDI
LCSAKRLKLLMQPLSSIHVRTETLALTKLEVWWYLLMRLGPQLPANFEQVCVPLIQSTIS
VDSI

Rif1_N

PFAM accession number:	PF12231
Interpro abstract (IPR022031):	This domain is found in N-terminal of the telomere-associated protein,Rif1. In budding yeast, Rif1 is Recruited to telomeres by interaction with the C terminus of RAP1 is recruited to telomeres by interaction with the C terminus of RAP1 and negatively regulates telomere length by preventing telomere elongation or promoting degradation of the telomere ends [ (PUBMED:1577274) (PUBMED:9087429) ]. In mammals, Rif1 is required for checkpoint mediated arrest of cell cycle progression in response to DNA damage during S-phase (the intra-S-phase checkpoint) [ (PUBMED:15342490) ].

PFAM accession number:

PF12231

Interpro abstract (IPR022031):

This domain is found in N-terminal of the telomere-associated protein,Rif1. In budding yeast, Rif1 is Recruited to telomeres by interaction with the C terminus of RAP1 is recruited to telomeres by interaction with the C terminus of RAP1 and negatively regulates telomere length by preventing telomere elongation or promoting degradation of the telomere ends [ (PUBMED:1577274) (PUBMED:9087429) ]. In mammals, Rif1 is required for checkpoint mediated arrest of cell cycle progression in response to DNA damage during S-phase (the intra-S-phase checkpoint) [ (PUBMED:15342490) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rif1_N