The domain within your query sequence starts at position 22 and ends at position 368; the E-value for the Rif1_N domain shown below is 3.3e-78.
PPGEQTDAYLTLTSRMTGEEGKEVIAEIEKNLSRLYTVLKAHISSQNSELSSAALQALGF CLYNPRITSGLSEANIQELLLTLNGIIKSSDKNVCTRALWVISKQTFPAELVSKMVSSII DSLEVILSKGEIHSAVVDFEALNVIISHWFLHCRLIEQAPVQMGEESVRWAKLVIPLVVH SAQKVHLRGATALEMGMPLLLQKQQEIALITEHLMTTKLISELQKLFKNKNETYVLKLWP LFVKLLGKTLHRSGSFINSLLQLEELGFRSGTPMIKKIAFIAWKSLIDNFALNPDILCSA KRLKLLMQPLSSIHVRTETLALTKLEVWWYLLMRLGPQLPANFEQVC
Rif1_N |
![]() |
---|
PFAM accession number: | PF12231 |
---|---|
Interpro abstract (IPR022031): | This domain is found in N-terminal of the telomere-associated protein,Rif1. In budding yeast, Rif1 is Recruited to telomeres by interaction with the C terminus of RAP1 is recruited to telomeres by interaction with the C terminus of RAP1 and negatively regulates telomere length by preventing telomere elongation or promoting degradation of the telomere ends [ (PUBMED:1577274) (PUBMED:9087429) ]. In mammals, Rif1 is required for checkpoint mediated arrest of cell cycle progression in response to DNA damage during S-phase (the intra-S-phase checkpoint) [ (PUBMED:15342490) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rif1_N