The domain within your query sequence starts at position 55 and ends at position 246; the E-value for the RimK domain shown below is 4.5e-45.
CVNKFWTFQELAGHGVPLPDTFSYGGHENFAKMIDEAEVLEFPMVVKNTRGHRGKAVFLA RDKHHLADLSHLIRHEAPYLFQKYIKESHGRDVRVIVVGGRVVGTMLRCSTDGRMQSNCS LGGVGMMCSLSEQGKQLAIQVSNILGTDVCGIDLLMKDDGSFCVCEANANVGFIAFDKAC NLDVAGIIADYA
RimK |
![]() |
---|
PFAM accession number: | PF08443 |
---|---|
Interpro abstract (IPR013651): | This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [ (PUBMED:9416615) ]. It has an unusual nucleotide-binding fold referred to as palmate, or ATP-grasp fold. This domain is found in a number of enzymes of known structure as well as in urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RimK