The domain within your query sequence starts at position 9 and ends at position 91; the E-value for the Rio2_N domain shown below is 9.5e-36.
LRYMSRDDFRVLTAVEMGMKNHEIVPCSLIASIASLKHGGCNKILRELVKHKLIAWERTK TVQGYRLTNAGYDYLALKTLSSR
Rio2_N |
![]() |
---|
PFAM accession number: | PF09202 |
---|---|
Interpro abstract (IPR015285): | This N-terminal domain is found in RIO2 kinases, and is structurally homologous to the winged helix (wHTH) domain. It adopts a structure consisting of four alpha helices followed by two beta strands and a fifth alpha helix. The domain confers DNA binding properties to the protein, as per other winged helix domains [ (PUBMED:15341724) ]. |
GO process: | protein phosphorylation (GO:0006468) |
GO function: | protein serine/threonine kinase activity (GO:0004674), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rio2_N