The domain within your query sequence starts at position 29 and ends at position 91; the E-value for the RmlD_sub_bind domain shown below is 4e-9.
RRVLITGATGLLGRAVYKEFQQSNWHTVGCGFRRARPKFEQVNLLDSEAVHHLIHDFQRE DLM
RmlD_sub_bind |
![]() |
---|
PFAM accession number: | PF04321 |
---|---|
Interpro abstract (IPR029903): | L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesised by four different enzymes. RmlD catalyses the final step of the dTDP-L-rhamnose synthesis. This entry represents the RmlD substrate binding domain, which is responsible for binding a sugar nucleotide [ (PUBMED:12057193) (PUBMED:10802738) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RmlD_sub_bind