The domain within your query sequence starts at position 1 and ends at position 53; the E-value for the Rod_cone_degen domain shown below is 2.8e-40.
MCTTLFLFSLAMLWRRRFTNRVEPEPSRVDGTVVGSGSDTDLQSTGREKGPVK
Rod_cone_degen |
![]() |
---|
PFAM accession number: | PF15201 |
---|---|
Interpro abstract (IPR027937): | PRCD is a secreted protein and a photoreceptor outer segment (OS) disc-specific protein involved in vision [ (PUBMED:24992209) (PUBMED:27613864) ]. Defects in the corresponding genes causes autosomal recessive retinal degeneration [ (PUBMED:16938425) ]. |
GO component: | photoreceptor outer segment membrane (GO:0042622) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rod_cone_degen