The domain within your query sequence starts at position 2 and ends at position 52; the E-value for the RuvB_N domain shown below is 5.5e-7.

AGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVL

RuvB_N

RuvB_N
PFAM accession number:PF05496
Interpro abstract (IPR008824):

The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein [ (PUBMED:12423347) ]. This entry represents the N-terminal domain of the protein.

GO process:DNA recombination (GO:0006310), DNA repair (GO:0006281)
GO function:four-way junction helicase activity (GO:0009378)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RuvB_N