The domain within your query sequence starts at position 2700 and ends at position 2790; the E-value for the RyR domain shown below is 1.1e-33.
FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPY KLLSEKEKEIYRWPIKESLKTMLAWGWRIER
RyR |
---|
PFAM accession number: | PF02026 |
---|---|
Interpro abstract (IPR003032): | This domain is called RyR for Ryanodine receptor [ (PUBMED:10664581) ]. The domain is found in four copies in the ryanodine receptor. A single copy of this domain encodes an unknown protein from Bacteroides thetaiotamicron, and and suggests that the repeats in RyRs may have a prokaryotic origin [ (PUBMED:22453942) ]. The function of this domain is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RyR