The domain within your query sequence starts at position 23 and ends at position 305; the E-value for the S-methyl_trans domain shown below is 3.9e-44.
VVGDSGFLFTLEKRGFVKAGLWTPEAVVEHPSAVRQLHTEFLRAGADVLQTFTFSATEDN MASKWEAVNAAACDLAQEVAGGGGALVAGGICQTSLYKYHKDETRIKNIFRLQLEVFARK NVDFLIAEYFEHVEEAVWAVEVLREVGAPVAVTMCIGPEGDMHDVTPGECAVKLARAGAD IIGVNCRFGPWTSLQTMKLMKEGLRDASLQAHLMVQCLGFHTPDCGKGGFVDLPEYPFGL EPRVATRWDIQKYAREAYNLGIRYIGGCCGFEPYHIRAIAEEL
S-methyl_trans |
---|
PFAM accession number: | PF02574 |
---|---|
Interpro abstract (IPR003726): | The homocysteine (Hcy) binding domain is an ~300-residue module which is found in a set of enzymes involved in alkyl transfer to thiols:
The Hcy-binding domain utilises a Zn(Cys)3 cluster to bind and activate Hcy. It has been shown to form a (beta/alpha)8 barrel. The Hcy binding domain barrel is distorted to form the metal- and substrate-binding sites. To accommodate the substrate, strands 1 and 2 of the barrel are loosely joined by nonclassic hydrogen bonds; to accommodate the metal, strands 6 and 8 are drawn together and strand 7 is extruded from the end of the barrel. The cysteines ligating the catalytic zinc atom are located at the C-terminal ends of strands 6 and 8 [ (PUBMED:12220488) (PUBMED:14752199) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry S-methyl_trans