The domain within your query sequence starts at position 55 and ends at position 112; the E-value for the S1-like domain shown below is 1.3e-29.
QRVFTGIVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVK
S1-like |
![]() |
---|
PFAM accession number: | PF14444 |
---|---|
Interpro abstract (IPR025223): | This entry represents the S1-like RNA binding domain found in deleted in breast cancer 1 (DBC1) and its paralogue cell division cycle and apoptosis regulator protein 1 (CARP1) [ (PUBMED:18418069) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry S1-like