The domain within your query sequence starts at position 21 and ends at position 67; the E-value for the S100PBPR domain shown below is 1.2e-23.

NASFPWGSLDEDELDDSLLEFSDGEEDDGHFSFTEEEIEMLLKDDDV

S100PBPR

• PFAM accession number: PF15427
• Interpro abstract (IPR026097):

  S100P-binding protein (S100PBP) interacts with S100P. S100P is a member of the S100 family of calcium-binding proteins and there have been several recent reports of its overexpression in pancreatic ductal adenocarcinoma (PDAC) [ (PUBMED:15632002) ].

• GO function: calcium-dependent protein binding (GO:0048306)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry S100PBPR