The domain within your query sequence starts at position 34 and ends at position 110; the E-value for the S8_pro-domain domain shown below is 1.2e-24.
SWAVRVTKGYQEAERLARKFGFVNLGQIFPDDQYFHLRHRGVAQQSLTPHWGHRLRLKKD PKVRWFEQQTLRRRVKR
S8_pro-domain |
 |
|---|
| PFAM accession number: | PF16470 |
|---|---|
| Interpro abstract (IPR032815): | This domain is the pro-domain of several peptidases belonging to family S8 [ (PUBMED:12095256) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry S8_pro-domain