The domain within your query sequence starts at position 817 and ends at position 854; the E-value for the SAE2 domain shown below is 1.4e-8.
ADLPAEEREKKLASCSRHRFRYIPPNTPENFWEVGFPS
SAE2 |
---|
PFAM accession number: | PF08573 |
---|---|
Interpro abstract (IPR013882): | This entry represents the C-terminal domain of the fission yeast Ctip protein. Proteins containing this domain include DNA endonuclease RBBP8 from animals and protein gamma response 1 (GR1) from Arabidopsis [ (PUBMED:11023598) ]. However, this entry does not include Sae2 from Saccharomyces cerevisiae. RBBP8 is an endonuclease that cooperates with the MRE11-RAD50-NBN (MRN) complex in processing meiotic and mitotic double-strand breaks (DSBs) by ensuring both resection and intrachromosomal association of the broken ends [ (PUBMED:17965729) ]. Ctp1 is an endonuclease that cooperates with the MRN complex in processing meiotic and mitotic double-strand breaks by allowing the endonucleolytic removal of rec12 from the break sites and ensuring both resection and intrachromosomal association of the broken ends [ (PUBMED:17936710) ]. |
GO process: | DNA repair (GO:0006281) |
GO function: | endonuclease activity (GO:0004519) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAE2