The domain within your query sequence starts at position 128 and ends at position 365; the E-value for the SAPS domain shown below is 2.7e-69.
LSILISRKPEQIVDFLKKKRDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQDVLNWLN EERIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQVQNSTEPDPLLATLEKQEI IEQLLSNIFHKEKNESAIVSAIQILLTLLETRRPTFEGHIEICPPGMSHSACSVNKSVLE AIRGRLGSFHELLLEPPKKSVMKTTWGILDPPVGNTRLNVIRLISSLLQTNTSSINGD
SAPS |
![]() |
---|
PFAM accession number: | PF04499 |
---|---|
Interpro abstract (IPR007587): | This entry includes budding yeast Sit4-associated proteins, such as Sap155, Sap185, and Sap190. Sit4 is a phosphatase involved in a variety of processes including transcription, translation, bud formation, glycogen metabolism, monovalent ion homeostasis, H+ transport, and telomere function [ (PUBMED:16769727) ]. This entry also includes mammalian PP6 (Sit4 homologue)-associated proteins, such as PP6R1, PP6R2, and PP6R3 [ (PUBMED:16769727) ]. They are regulatory subunits of PP6 involved in the PP6-mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha [ (PUBMED:16769727) ]. |
GO process: | regulation of phosphoprotein phosphatase activity (GO:0043666) |
GO function: | protein phosphatase binding (GO:0019903) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SAPS