The domain within your query sequence starts at position 745 and ends at position 783; the E-value for the SARA domain shown below is 1.3e-22.
SPNPNNPAEYCSTIPPLQQAQASGALSSPPPTVMVPVGV
SARA |
---|
PFAM accession number: | PF11409 |
---|---|
Interpro abstract (IPR024608): | Smad proteins mediate transforming growth factor-beta (TGF-beta) signaling from the transmembrane serine-threonine receptor kinases to the nucleus. SARA (Smad anchor for receptor activation) recruits Smad2 to the TGF-beta receptors for phosphorylation [ (PUBMED:10615055) ]. This entry represents the Smad-binding domain (SBD) of SARA. This domain consists of a rigid coil, an alpha helix, and a beta strand, and interacts with Smad2 [ (PUBMED:10615055) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SARA