SMART: Pfam domain SCAPER

The domain within your query sequence starts at position 88 and ends at position 185; the E-value for the SCAPER_N domain shown below is 3.4e-47.

KTRHPRKIDLRARYWAFLFDNLRRAVDEIYVTCESDQSVVECKEVLMMLDYYVRDFKALI
DWIQLQEKLEKTDAQSRPTSLAWEVKKMSPGRHVIQSP

SCAPER_N

PFAM accession number:	PF16501
Interpro abstract (IPR032446):	This entry represents a short highly conserved region close to the N terminus of SCAPER. SCAPER is an ER-localised protein and a substrate for cyclin A/Cdk2. One theory suggests that SCAPER functions to create a local high concentration of cyclin A2 in the cytoplasm. Alternatively, SCAPER might be acting to sequester a portion of cellular cyclin A2 that could then be readily available for nuclear translocation, which may be needed for exit from G0 phase [ (PUBMED:17698606) (PUBMED:18272469) ].

PFAM accession number:

PF16501

Interpro abstract (IPR032446):

This entry represents a short highly conserved region close to the N terminus of SCAPER. SCAPER is an ER-localised protein and a substrate for cyclin A/Cdk2. One theory suggests that SCAPER functions to create a local high concentration of cyclin A2 in the cytoplasm. Alternatively, SCAPER might be acting to sequester a portion of cellular cyclin A2 that could then be readily available for nuclear translocation, which may be needed for exit from G0 phase [ (PUBMED:17698606) (PUBMED:18272469) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SCAPER_N