The domain within your query sequence starts at position 43 and ends at position 160; the E-value for the SCF domain shown below is 1.1e-69.
ALPTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMD VLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAP
SCF |
---|
PFAM accession number: | PF02404 |
---|---|
Interpro abstract (IPR003452): | Stem cell factor (SCF) is a homodimer involved in hematopoiesis. SCF binds to and activates KIT, a receptor tyrosine kinase [ (PUBMED:17662946) ]. SCF stimulates the proliferation of mast cells and is able to augment the proliferation of both myeloid and lymphoid hematopoietic progenitors in bone marrow culture. It also mediates cell-cell adhesion and acts synergistically with other cytokines. SCF is a type I membrane protein, but is also found in a secretable, soluble form. The crystal structure of human SCF has been resolved and a potential receptor-binding site identified [ (PUBMED:10884405) ]. |
GO process: | cell adhesion (GO:0007155) |
GO component: | membrane (GO:0016020) |
GO function: | stem cell factor receptor binding (GO:0005173) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SCF