The domain within your query sequence starts at position 1 and ends at position 132; the E-value for the SCIMP domain shown below is 1.9e-70.
MSWWRDNFWIILAMSIIFISLVLGLILYCVCRWQLRQGRNWEIAKPSKQDGRDEEKMYEN VLNSSPGQLPALPPRGSPFPGDLAPQEAPRQPSAWYSSVKKVRNKKVFAISGSTEPENDY DDVEIPATTETQ
SCIMP |
---|
PFAM accession number: | PF15050 |
---|---|
Interpro abstract (IPR028181): | SLP adapter and CSK-interacting membrane protein (SCIMP) is a lipid tetraspanin-associated transmembrane adapter/mediator involved in major histocompatibility complex class II (MHC-II) signaling transduction [ (PUBMED:21930792) ]. SCIMP is expressed in B cells and other professional antigen-presenting cells (APCs) and is localised in the immunological synapse. Upon MHC-II stimulation, phosphorylated SCIMP binds to the SLP65 and to the inhibitory kinase Csk. SLP65 binding initiates the downstream signaling cascades, while Csk binding functions as a negative regulatory loop [ (PUBMED:21930792) ]. |
GO component: | integral component of membrane (GO:0016021), immunological synapse (GO:0001772), tetraspanin-enriched microdomain (GO:0097197) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SCIMP