The domain within your query sequence starts at position 409 and ends at position 532; the E-value for the SDA1 domain shown below is 2.4e-41.
MTEELLQDLAQYKTHKDKNVMMSARTLIHLFRTLNPQMLQKKFRGKPTEASIEARIQEYG ELDAKDYIPGAEVLELEKGDNTEDDEDGWESASLSEEEEEDGEWVDVHHSSDEEQQAIAT KLDS
SDA1 |
![]() |
---|
PFAM accession number: | PF05285 |
---|---|
Interpro abstract (IPR007949): | This domain is found in several SDA1 protein homologues. SDA1 is a Saccharomyces cerevisiae protein which is involved in the control of the actin cytoskeleton. The protein is essential for cell viability and is localised in the nucleus [ (PUBMED:10704371) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SDA1